Lineage for d4zsca_ (4zsc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801680Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 1801681Species Human (Homo sapiens) [TaxId:9606] [141512] (30 PDB entries)
    Uniprot P30405 44-207
  8. 1801708Domain d4zsca_: 4zsc A: [276093]
    automated match to d4o8ha_
    complexed with ea4

Details for d4zsca_

PDB Entry: 4zsc (more details), 1.5 Å

PDB Description: human cyclophilin d complexed with an inhibitor at room temperature
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d4zsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zsca_ b.62.1.1 (A:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d4zsca_:

Click to download the PDB-style file with coordinates for d4zsca_.
(The format of our PDB-style files is described here.)

Timeline for d4zsca_: