SCOPe 2.06: Domain d4zb1b_: 4zb1 B:

Lineage for d4zb1b_ (4zb1 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Stichodactyla gigantea [TaxId:230562] [276086] (1 PDB entry)

8. Domain d4zb1b_: 4zb1 B: [276088]
   automated match to d2c9ia_
   complexed with toe

Details for d4zb1b_

PDB Entry: 4zb1, 2.25 Å

PDB Description: crystal structure of blue chromoprotein sgbp from stichodactyla gigantea

PDB Compounds: (B:) Blue chromoprotein, sgBP

SCOPe Domain Sequences for d4zb1b_:

Sequence; same for both SEQRES and ATOM records:

>d4zb1b_ d.22.1.0 (B:) automated matches {Stichodactyla gigantea [TaxId: 230562]}
aipenvrikafmegainnhhfkceaegegkpyegtqlerirvteggplpfsfdilsphfq
ygsvaitkylsgipdyfkqsfpegfswerttmyedggyvtahqdtsldgnclvykikvig
snlpangpvmqnktrgwepctemryvrggvlcgqslmalkcadgnhltcqlrttyrskkp
akklqmpafhfsdhrpeilkvsengnlmeqyemsvgrycesvpsklghn

Timeline for d4zb1b_:

• d4zb1b_ first appeared in SCOPe 2.05
  
• d4zb1b_ appears in SCOPe 2.07
  
• d4zb1b_ appears in the current release, SCOPe 2.08