Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (21 species) not a true protein |
Species Stichodactyla gigantea [TaxId:230562] [276086] (1 PDB entry) |
Domain d4zb1b_: 4zb1 B: [276088] automated match to d2c9ia_ complexed with toe |
PDB Entry: 4zb1 (more details), 2.25 Å
SCOPe Domain Sequences for d4zb1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zb1b_ d.22.1.0 (B:) automated matches {Stichodactyla gigantea [TaxId: 230562]} aipenvrikafmegainnhhfkceaegegkpyegtqlerirvteggplpfsfdilsphfq ygsvaitkylsgipdyfkqsfpegfswerttmyedggyvtahqdtsldgnclvykikvig snlpangpvmqnktrgwepctemryvrggvlcgqslmalkcadgnhltcqlrttyrskkp akklqmpafhfsdhrpeilkvsengnlmeqyemsvgrycesvpsklghn
Timeline for d4zb1b_: