SCOPe 2.05: Domain d4z8kb_: 4z8k B:

Lineage for d4z8kb_ (4z8k B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (8 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189583] (4 PDB entries)

8. Domain d4z8kb_: 4z8k B: [276081]
   Other proteins in same PDB: d4z8ka_
   automated match to d1ktpb_
   complexed with cyc

Details for d4z8kb_

PDB Entry: 4z8k, 2.5 Å

PDB Description: phycocyanin structure from t. elongatus at 2.5-a from xfel using a viscous delivery medium for serial femtosecond crystallography

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d4z8kb_:

Sequence; same for both SEQRES and ATOM records:

>d4z8kb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d4z8kb_:

• d4z8kb_ is new in SCOPe 2.05-stable
  
• d4z8kb_ appears in SCOPe 2.06
  
• d4z8kb_ appears in the current release, SCOPe 2.08