| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein Phycocyanin beta subunit [88940] (9 species) |
| Species Thermosynechococcus elongatus [TaxId:197221] [189583] (12 PDB entries) |
| Domain d4z8kb_: 4z8k B: [276081] Other proteins in same PDB: d4z8ka_ automated match to d1ktpb_ complexed with cyc |
PDB Entry: 4z8k (more details), 2.5 Å
SCOPe Domain Sequences for d4z8kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z8kb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d4z8kb_: