Lineage for d4z5qa_ (4z5q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005880Species Streptomyces atroolivaceus [TaxId:66869] [275512] (2 PDB entries)
  8. 2005881Domain d4z5qa_: 4z5q A: [276080]
    automated match to d2nzaa_
    complexed with 1pe, cl, hem, mg, p33

Details for d4z5qa_

PDB Entry: 4z5q (more details), 1.8 Å

PDB Description: crystal structure of the lnmz cytochrome p450 hydroxylase from the leinamycin biosynthetic pathway of streptomyces atroolivaceus s-140 at 1.8 a resolution
PDB Compounds: (A:) Cytochrome P450 hydroxylase

SCOPe Domain Sequences for d4z5qa_:

Sequence, based on SEQRES records: (download)

>d4z5qa_ a.104.1.0 (A:) automated matches {Streptomyces atroolivaceus [TaxId: 66869]}
papvaypftgseglelsqsyaklfedgdpirvqlpfgepawlvtryddarfvltdrrfsr
hlatqrdeprmtpravpesiltmdppdhtrlrtlvskaftprrieskrawigelaaglva
dmkaggapaelvgsyalaipvtvicellgvpeddrtrlrgwcdaalstgeltdeecvqsf
mdlqkyfedlvkerraeprddltsalieardahdrlaepeliglcisiliggfettasei
ssfvhvlqqrrelwtrlcadpeaipaaveellrfvpfaangispryaledmtvggvlvre
gepvivdtsavnrdglvfdnadevvidradnrhmvfghgahhclgahlarvelqealkal
vegmpglrlsgdvewkadmiiraprvmhvew

Sequence, based on observed residues (ATOM records): (download)

>d4z5qa_ a.104.1.0 (A:) automated matches {Streptomyces atroolivaceus [TaxId: 66869]}
papvaypfdgdpirvqlpfgepawlvtryddarfvltdrrfsrhlatqrdeprmtpravp
esiltmdppdhtrlrtlvskaftprrieskrawigelaaglvadmkaggapaelvgsyal
aipvtvicellgvpeddrtrlrgwcdaalstgeltdeecvqsfmdlqkyfedlvkerrae
prddltsalieardahdrlaepeliglcisiliggfettaseissfvhvlqqrrelwtrl
cadpeaipaaveellrfvpfaangispryaledmtvggvlvregepvivdtsavnrdglv
fdnadevvidradnrhmvfghgahhclgahlarvelqealkalvegmpglrlsgdaprvm
hvew

SCOPe Domain Coordinates for d4z5qa_:

Click to download the PDB-style file with coordinates for d4z5qa_.
(The format of our PDB-style files is described here.)

Timeline for d4z5qa_: