Lineage for d1eusa_ (1eus A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065183Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 2065184Species Micromonospora viridifaciens [TaxId:1881] [50947] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 2065188Domain d1eusa_: 1eus A: [27608]
    complexed with dan

Details for d1eusa_

PDB Entry: 1eus (more details), 2 Å

PDB Description: sialidase complexed with 2-deoxy-2,3-dehydro-n-acetylneuraminic acid
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1eusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eusa_ b.68.1.1 (A:) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggi

SCOPe Domain Coordinates for d1eusa_:

Click to download the PDB-style file with coordinates for d1eusa_.
(The format of our PDB-style files is described here.)

Timeline for d1eusa_: