SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1eura_ (1eur A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065183Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 2065184Species Micromonospora viridifaciens [TaxId:1881] [50947] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 2065186Domain d1eura_: 1eur A: [27607]

Details for d1eura_

PDB Entry: 1eur (more details), 1.82 Å

PDB Description: sialidase
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1eura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eura_ b.68.1.1 (A:) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
p

SCOPe Domain Coordinates for d1eura_:

Click to download the PDB-style file with coordinates for d1eura_.
(The format of our PDB-style files is described here.)

Timeline for d1eura_: