Lineage for d1eura_ (1eur A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398406Protein Micromonospora sialidase, N-terminal domain [50946] (1 species)
  7. 2398407Species Micromonospora viridifaciens [TaxId:1881] [50947] (6 PDB entries)
    Uniprot Q02834 47-647
  8. 2398409Domain d1eura_: 1eur A: [27607]

Details for d1eura_

PDB Entry: 1eur (more details), 1.82 Å

PDB Description: sialidase
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1eura_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eura_ b.68.1.1 (A:) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]}
geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
iinaagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkv
avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
p

SCOPe Domain Coordinates for d1eura_:

Click to download the PDB-style file with coordinates for d1eura_.
(The format of our PDB-style files is described here.)

Timeline for d1eura_: