Lineage for d4xx0b2 (4xx0 B:246-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464502Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2464503Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2464561Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2464589Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)
  8. 2464598Domain d4xx0b2: 4xx0 B:246-393 [276063]
    Other proteins in same PDB: d4xx0a1, d4xx0a2, d4xx0b1
    automated match to d1eucb1
    complexed with coa, gol, po4, so4

Details for d4xx0b2

PDB Entry: 4xx0 (more details), 2.1 Å

PDB Description: coa bound to pig gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d4xx0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xx0b2 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOPe Domain Coordinates for d4xx0b2:

Click to download the PDB-style file with coordinates for d4xx0b2.
(The format of our PDB-style files is described here.)

Timeline for d4xx0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xx0b1