SCOPe 2.06: Domain d4xx0b2: 4xx0 B:246-393

Lineage for d4xx0b2 (4xx0 B:246-393)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (8 PDB entries)

8. Domain d4xx0b2: 4xx0 B:246-393 [276063]
   Other proteins in same PDB: d4xx0a1, d4xx0a2, d4xx0b1
   automated match to d1eucb1
   complexed with coa, gol, po4, so4

Details for d4xx0b2

PDB Entry: 4xx0, 2.1 Å

PDB Description: coa bound to pig gtp-specific succinyl-coa synthetase

PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d4xx0b2:

Sequence; same for both SEQRES and ATOM records:

>d4xx0b2 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d4xx0b2:

• d4xx0b2 first appeared in SCOPe 2.05
  
• d4xx0b2 appears in SCOPe 2.07
  
• d4xx0b2 appears in the current release, SCOPe 2.08