Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries) GTP-specific enzyme |
Domain d4xx0b1: 4xx0 B:1-245 [276062] Other proteins in same PDB: d4xx0a1, d4xx0a2, d4xx0b2 automated match to d1eudb2 complexed with coa, gol, po4, so4 |
PDB Entry: 4xx0 (more details), 2.1 Å
SCOPe Domain Sequences for d4xx0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xx0b1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd dksen
Timeline for d4xx0b1: