Lineage for d4xx0b1 (4xx0 B:1-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978768Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2978769Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2978797Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries)
    GTP-specific enzyme
  8. 2978805Domain d4xx0b1: 4xx0 B:1-245 [276062]
    Other proteins in same PDB: d4xx0a1, d4xx0a2, d4xx0b2
    automated match to d1eudb2
    complexed with coa, gol, po4, so4

Details for d4xx0b1

PDB Entry: 4xx0 (more details), 2.1 Å

PDB Description: coa bound to pig gtp-specific succinyl-coa synthetase
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial

SCOPe Domain Sequences for d4xx0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xx0b1 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d4xx0b1:

Click to download the PDB-style file with coordinates for d4xx0b1.
(The format of our PDB-style files is described here.)

Timeline for d4xx0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xx0b2