SCOPe 2.05: Domain d4xx0a1: 4xx0 A:2-130

Lineage for d4xx0a1 (4xx0 A:2-130)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51903] (7 PDB entries)

8. Domain d4xx0a1: 4xx0 A:2-130 [276060]
   Other proteins in same PDB: d4xx0a2, d4xx0b1, d4xx0b2
   automated match to d1euda1
   complexed with coa, gol, po4, so4

Details for d4xx0a1

PDB Entry: 4xx0, 2.1 Å

PDB Description: coa bound to pig gtp-specific succinyl-coa synthetase

PDB Compounds: (A:) Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial

SCOPe Domain Sequences for d4xx0a1:

Sequence; same for both SEQRES and ATOM records:

>d4xx0a1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

Timeline for d4xx0a1:

• d4xx0a1 is new in SCOPe 2.05-stable
  
• d4xx0a1 appears in SCOPe 2.06
  
• d4xx0a1 appears in the current release, SCOPe 2.08