Lineage for d1b9ta_ (1b9t A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065105Species Influenza B virus, different strains [TaxId:11520] [50945] (18 PDB entries)
  8. 2065159Domain d1b9ta_: 1b9t A: [27606]
    complexed with ca, nag, rai

Details for d1b9ta_

PDB Entry: 1b9t (more details), 2.4 Å

PDB Description: novel aromatic inhibitors of influenza virus neuraminidase make selective interactions with conserved residues and water molecules in the active site
PDB Compounds: (A:) protein (neuraminidase)

SCOPe Domain Sequences for d1b9ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ta_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
epewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthya
aqpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmg
melyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkd
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d1b9ta_:

Click to download the PDB-style file with coordinates for d1b9ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b9ta_: