![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.0: automated matches [276056] (1 protein) not a true family |
![]() | Protein automated matches [276057] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [276058] (2 PDB entries) |
![]() | Domain d4xxbb_: 4xxb B: [276059] automated match to d2c6ba_ protein/RNA complex; complexed with bme, imd, zn |
PDB Entry: 4xxb (more details), 2.4 Å
SCOPe Domain Sequences for d4xxbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xxbb_ g.41.11.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} edpeisladywkctscnemnpplpshcnrcwalrenwlpedk
Timeline for d4xxbb_: