Lineage for d4xxbb_ (4xxb B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037357Family g.41.11.0: automated matches [276056] (1 protein)
    not a true family
  6. 3037358Protein automated matches [276057] (1 species)
    not a true protein
  7. 3037359Species Human (Homo sapiens) [TaxId:9606] [276058] (2 PDB entries)
  8. 3037360Domain d4xxbb_: 4xxb B: [276059]
    automated match to d2c6ba_
    protein/RNA complex; complexed with bme, imd, zn

Details for d4xxbb_

PDB Entry: 4xxb (more details), 2.4 Å

PDB Description: crystal structure of human mdm2-rpl11
PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4xxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xxbb_ g.41.11.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edpeisladywkctscnemnpplpshcnrcwalrenwlpedk

SCOPe Domain Coordinates for d4xxbb_:

Click to download the PDB-style file with coordinates for d4xxbb_.
(The format of our PDB-style files is described here.)

Timeline for d4xxbb_: