SCOPe 2.05: Domain d4wrld_: 4wrl D:

Lineage for d4wrld_ (4wrl D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (14 PDB entries)

8. Domain d4wrld_: 4wrl D: [276043]
   automated match to d3uf5a_
   complexed with fuc, gal, nag, sia

Details for d4wrld_

PDB Entry: 4wrl, 2.8 Å

PDB Description: structure of the human csf-1:csf-1r complex

PDB Compounds: (D:) macrophage colony-stimulating factor 1

SCOPe Domain Sequences for d4wrld_:

Sequence, based on SEQRES records:

>d4wrld_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
netknlldkdwnifskncnnsfaec

Sequence, based on observed residues (ATOM records):

>d4wrld_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
edtmrfrdntpnaiaivqlqelslrlkscftkdykacvrtfyetplqllekvknvfnetk
nlldkdwnifskncnnsfaec

Timeline for d4wrld_:

• d4wrld_ is new in SCOPe 2.05-stable
  
• d4wrld_ appears in SCOPe 2.06
  
• d4wrld_ appears in the current release, SCOPe 2.08