Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
Protein automated matches [190746] (12 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [196473] (3 PDB entries) |
Domain d4wiga_: 4wig A: [276041] automated match to d1r5tc_ complexed with zn; mutant |
PDB Entry: 4wig (more details), 1.76 Å
SCOPe Domain Sequences for d4wiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wiga_ c.97.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvdwnmlrgnatqaaagayvpysrfavgaaalvddgrvvtgcnvdnvsygltlcaecavv calhstgggrllalacvdghgsvlmpcgrcrqvllehggsellidhpvrprrlgdllpda fglddl
Timeline for d4wiga_: