SCOPe 2.06: Domain d4wiga_: 4wig A:

Lineage for d4wiga_ (4wig A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (12 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196473] (3 PDB entries)

8. Domain d4wiga_: 4wig A: [276041]
   automated match to d1r5tc_
   complexed with zn; mutant

Details for d4wiga_

PDB Entry: 4wig, 1.76 Å

PDB Description: crystal structure of e47d mutant cytidine deaminase from mycobacterium tuberculosis (mtcda e47d)

PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d4wiga_:

Sequence; same for both SEQRES and ATOM records:

>d4wiga_ c.97.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvdwnmlrgnatqaaagayvpysrfavgaaalvddgrvvtgcnvdnvsygltlcaecavv
calhstgggrllalacvdghgsvlmpcgrcrqvllehggsellidhpvrprrlgdllpda
fglddl

Timeline for d4wiga_:

• d4wiga_ first appeared in SCOPe 2.05
  
• d4wiga_ appears in SCOPe 2.07
  
• d4wiga_ appears in the current release, SCOPe 2.08