Lineage for d4uu9b_ (4uu9 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756306Domain d4uu9b_: 4uu9 B: [276038]
    Other proteins in same PDB: d4uu9a_, d4uu9c1, d4uu9c2, d4uu9d1, d4uu9d2, d4uu9h_
    automated match to d3lrga_
    complexed with so4

Details for d4uu9b_

PDB Entry: 4uu9 (more details), 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody
PDB Compounds: (B:) medi7814

SCOPe Domain Sequences for d4uu9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu9b_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsglsn
rfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvla

SCOPe Domain Coordinates for d4uu9b_:

Click to download the PDB-style file with coordinates for d4uu9b_.
(The format of our PDB-style files is described here.)

Timeline for d4uu9b_: