![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d4uu9h_: 4uu9 H: [276037] Other proteins in same PDB: d4uu9b_, d4uu9c1, d4uu9c2, d4uu9d1, d4uu9d2, d4uu9l_ automated match to d3zhka_ complexed with so4 |
PDB Entry: 4uu9 (more details), 2.12 Å
SCOPe Domain Sequences for d4uu9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uu9h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy adsvkgrftisrdnskntlylqmnslraedtavyycardddyeewpwyygmdvwgqgtmv tvs
Timeline for d4uu9h_: