Lineage for d4uu9h_ (4uu9 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742769Domain d4uu9h_: 4uu9 H: [276037]
    Other proteins in same PDB: d4uu9b_, d4uu9c1, d4uu9c2, d4uu9d1, d4uu9d2, d4uu9l_
    automated match to d3zhka_
    complexed with so4

Details for d4uu9h_

PDB Entry: 4uu9 (more details), 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody
PDB Compounds: (H:) medi7814

SCOPe Domain Sequences for d4uu9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu9h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycardddyeewpwyygmdvwgqgtmv
tvs

SCOPe Domain Coordinates for d4uu9h_:

Click to download the PDB-style file with coordinates for d4uu9h_.
(The format of our PDB-style files is described here.)

Timeline for d4uu9h_: