Lineage for d4uuic1 (4uui C:2-297)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443681Species Escherichia coli [TaxId:469008] [189446] (6 PDB entries)
  8. 2443695Domain d4uuic1: 4uui C:2-297 [276033]
    Other proteins in same PDB: d4uuia2, d4uuib2, d4uuic2, d4uuid2
    automated match to d2wnza_
    complexed with 1pe, na, pyr

Details for d4uuic1

PDB Entry: 4uui (more details), 1.79 Å

PDB Description: a case study for twinned data analysis: multiple crystal forms of the enzyme n-acetyl-neuraminic lyase
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4uuic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uuic1 c.1.10.1 (C:2-297) automated matches {Escherichia coli [TaxId: 469008]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvfnipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqirreh
pdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

SCOPe Domain Coordinates for d4uuic1:

Click to download the PDB-style file with coordinates for d4uuic1.
(The format of our PDB-style files is described here.)

Timeline for d4uuic1: