SCOPe 2.05: Domain d4uuia_: 4uui A:

Lineage for d4uuia_ (4uui A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (20 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [189446] (6 PDB entries)

8. Domain d4uuia_: 4uui A: [276032]
   automated match to d2wnza_
   complexed with 1pe, na, pyr

Details for d4uuia_

PDB Entry: 4uui, 1.79 Å

PDB Description: a case study for twinned data analysis: multiple crystal forms of the enzyme n-acetyl-neuraminic lyase

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4uuia_:

Sequence; same for both SEQRES and ATOM records:

>d4uuia_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
hhhhatnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqsls
ereqvleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfee
hcdhyraiidsadglpmvvfnipalsgvkltldqintlvtlpgvgalxqtsgdlyqmeqi
rrehpdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqt
ecnkvidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

Timeline for d4uuia_:

• d4uuia_ is new in SCOPe 2.05-stable
  
• d4uuia_ is called d4uuia1 in SCOPe 2.06
  
• d4uuia_ appears in the current release, SCOPe 2.08, called d4uuia1