SCOPe 2.08: Domain d4uu9c1: 4uu9 C:1-64

Lineage for d4uu9c1 (4uu9 C:1-64)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein automated matches [257397] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [276021] (1 PDB entry)

8. Domain d4uu9c1: 4uu9 C:1-64 [276022]
   Other proteins in same PDB: d4uu9a_, d4uu9b_, d4uu9c2, d4uu9d2, d4uu9h_, d4uu9l_
   automated match to d1kjsa_
   complexed with so4

Details for d4uu9c1

PDB Entry: 4uu9, 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody

PDB Compounds: (C:) Complement C5

SCOPe Domain Sequences for d4uu9c1:

Sequence; same for both SEQRES and ATOM records:

>d4uu9c1 a.50.1.1 (C:1-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lran

Timeline for d4uu9c1:

• d4uu9c1 first appeared in SCOPe 2.05, called d4uu9c_
  
• d4uu9c1 appears in SCOPe 2.07