Lineage for d1inf__ (1inf -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17093Species Influenza B virus, different strains [TaxId:11520] [50945] (11 PDB entries)
  8. 17105Domain d1inf__: 1inf - [27602]

Details for d1inf__

PDB Entry: 1inf (more details), 2.4 Å

PDB Description: influenza virus b/lee/40 neuraminidase complexed with bana113 inhibitor

SCOP Domain Sequences for d1inf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inf__ b.68.1.1 (-) Influenza neuraminidase {Influenza B virus, different strains}
epewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthya
aqpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmg
melyvkydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkd
twhsaataiyclmgsgqllwdtvtgvdmal

SCOP Domain Coordinates for d1inf__:

Click to download the PDB-style file with coordinates for d1inf__.
(The format of our PDB-style files is described here.)

Timeline for d1inf__: