SCOP 1.75: Domain d1a4gb_: 1a4g B:

Lineage for d1a4gb_ (1a4g B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (2 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)

6. Protein Influenza neuraminidase [50943] (2 species)

7. Species Influenza B virus, different strains [TaxId:11520] [50945] (12 PDB entries)

8. Domain d1a4gb_: 1a4g B: [27601]
   complexed with ca, nag, zmr

Details for d1a4gb_

PDB Entry: 1a4g, 2.2 Å

PDB Description: influenza virus b/beijing/1/87 neuraminidase complexed with zanamivir

PDB Compounds: (B:) Neuraminidase

SCOP Domain Sequences for d1a4gb_:

Sequence; same for both SEQRES and ATOM records:

>d1a4gb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal

Timeline for d1a4gb_:

• d1a4gb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4gb_ appears in SCOP 1.73
  
• d1a4gb_ appears in SCOPe 2.01
  
• d1a4gb_ appears in the current release, SCOPe 2.08