Lineage for d4uj3f_ (4uj3 F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969472Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 1969473Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 1969486Protein automated matches [275997] (1 species)
    not a true protein
  7. 1969487Species Homo sapiens [TaxId:9606] [275998] (1 PDB entry)
  8. 1969488Domain d4uj3f_: 4uj3 F: [275999]
    Other proteins in same PDB: d4uj3a_, d4uj3d_, d4uj3g_, d4uj3j_, d4uj3m_, d4uj3p_, d4uj3s_, d4uj3v_
    automated match to d2hv8e_
    complexed with gnp, mg, pg4, so4

Details for d4uj3f_

PDB Entry: 4uj3 (more details), 3 Å

PDB Description: crystal structure of human rab11-rabin8-fip3
PDB Compounds: (F:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d4uj3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uj3f_ h.1.31.1 (F:) automated matches {Homo sapiens [TaxId: 9606]}
lmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOPe Domain Coordinates for d4uj3f_:

Click to download the PDB-style file with coordinates for d4uj3f_.
(The format of our PDB-style files is described here.)

Timeline for d4uj3f_: