Lineage for d4u88b_ (4u88 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984777Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984778Protein automated matches [190858] (17 species)
    not a true protein
  7. 1984841Species Staphylococcus aureus [TaxId:1458279] [275992] (1 PDB entry)
  8. 1984843Domain d4u88b_: 4u88 B: [275994]
    automated match to d4ixaa_

Details for d4u88b_

PDB Entry: 4u88 (more details), 2.36 Å

PDB Description: structure of the dna-binding domain of the response regulator saer from staphylococcus aureus
PDB Compounds: (B:) Transcriptional regulator SaeR

SCOPe Domain Sequences for d4u88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u88b_ a.4.6.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
edantvnvhihrireklekesfttytittvwglgykfer

SCOPe Domain Coordinates for d4u88b_:

Click to download the PDB-style file with coordinates for d4u88b_.
(The format of our PDB-style files is described here.)

Timeline for d4u88b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4u88a_