Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (24 species) not a true protein |
Species Staphylococcus aureus [TaxId:1458279] [275992] (1 PDB entry) |
Domain d4u88a_: 4u88 A: [275993] automated match to d4ixaa_ |
PDB Entry: 4u88 (more details), 2.36 Å
SCOPe Domain Sequences for d4u88a_:
Sequence, based on SEQRES records: (download)
>d4u88a_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1458279]} eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy edantvnvhihrireklekesfttytittvwglgykfers
>d4u88a_ a.4.6.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1458279]} eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwantvn vhihrireklekesfttytittvwglgykfers
Timeline for d4u88a_: