Lineage for d1nsbb_ (1nsb B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2398208Protein Influenza neuraminidase [50943] (5 species)
  7. 2398328Species Influenza B virus [TaxId:11520] [50945] (18 PDB entries)
  8. 2398398Domain d1nsbb_: 1nsb B: [27598]
    complexed with ca, nag

Details for d1nsbb_

PDB Entry: 1nsb (more details), 2.2 Å

PDB Description: the 2.2 angstroms resolution crystal structure of influenza b neuraminidase and its complex with sialic acid
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d1nsbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsbb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza B virus [TaxId: 11520]}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d1nsbb_:

Click to download the PDB-style file with coordinates for d1nsbb_.
(The format of our PDB-style files is described here.)

Timeline for d1nsbb_: