SCOPe 2.05: Domain d4tkdb_: 4tkd B:

Lineage for d4tkdb_ (4tkd B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.18: Hjc-like [64080] (3 proteins)
   Pfam PF01870

6. Protein automated matches [190866] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [275977] (2 PDB entries)

8. Domain d4tkdb_: 4tkd B: [275978]
   automated match to d2eo0a_
   mutant

Details for d4tkdb_

PDB Entry: 4tkd, 2.01 Å

PDB Description: sulfolobus solfataricus hjc mutants

PDB Compounds: (B:) Holliday junction resolvase Hjc

SCOPe Domain Sequences for d4tkdb_:

Sequence, based on SEQRES records:

>d4tkdb_ c.52.1.18 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
savernivsrlrdkgfavvrapasgskrkdpipdiialkngviiliemksrkdgkiyvrr
eqaegiiefarksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrl
veakisr

Sequence, based on observed residues (ATOM records):

>d4tkdb_ c.52.1.18 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
savernivsrlrdkgfavvrappipdiialkngviiliemksrgkiyvrreqaegiiefa
rksggslflgvkkpgvlkfipfeklrrtetgnyvadseiegldledlvrlveakisr

Timeline for d4tkdb_:

• d4tkdb_ is new in SCOPe 2.05-stable
  
• d4tkdb_ appears in SCOPe 2.06
  
• d4tkdb_ appears in the current release, SCOPe 2.08