Lineage for d4r2na_ (4r2n A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867790Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)
  8. 1867801Domain d4r2na_: 4r2n A: [275973]
    automated match to d3ffha_
    complexed with epe, phe, plp

Details for d4r2na_

PDB Entry: 4r2n (more details), 1.98 Å

PDB Description: crystal structure of rv3772 in complex with its substrate
PDB Compounds: (A:) Putative phenylalanine aminotransferase

SCOPe Domain Sequences for d4r2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r2na_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vtarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcv
qlkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrva
gaipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahil
iaideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitald
kvyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvw
lplgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq

SCOPe Domain Coordinates for d4r2na_:

Click to download the PDB-style file with coordinates for d4r2na_.
(The format of our PDB-style files is described here.)

Timeline for d4r2na_:

  • d4r2na_ appears in periodic updates to SCOPe 2.05 starting on 2015-08-13
  • d4r2na_ is called d4r2na1 in SCOPe 2.06
  • d4r2na_ appears in the current release, SCOPe 2.07, called d4r2na1