SCOPe 2.06: Domain d4r2nb1: 4r2n B:2-353

Lineage for d4r2nb1 (4r2n B:2-353)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)

8. Domain d4r2nb1: 4r2n B:2-353 [275972]
   Other proteins in same PDB: d4r2na2, d4r2nb2, d4r2nc2, d4r2nd2
   automated match to d3ffha_
   complexed with epe, phe, plp

Details for d4r2nb1

PDB Entry: 4r2n, 1.98 Å

PDB Description: crystal structure of rv3772 in complex with its substrate

PDB Compounds: (B:) Putative phenylalanine aminotransferase

SCOPe Domain Sequences for d4r2nb1:

Sequence; same for both SEQRES and ATOM records:

>d4r2nb1 c.67.1.0 (B:2-353) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tarlrpelaglpvyvpgktvpgaiklasnetvfgplpsvraaidratdtvnrypdngcvq
lkaalarhlgpdfapehvavgcgsvslcqqlvqvtasvgdevvfgwrsfelyppqvrvag
aipiqvpltdhtfdlyamlatvtdrtrlifvcnpnnptstvvgpdalarfveavpahili
aideayveyirdgmrpdslglvrahnnvvvlrtfskayglaglrigyaighpdvitaldk
vyvpftvssigqaaaiasldaadellartdtvvaerarvsaelraagftlppsqanfvwl
plgsrtqdfveqaadarivvrpygtdgvrvtvaapeendaflrfarrwrsdq

Timeline for d4r2nb1:

• d4r2nb1 first appeared in SCOPe 2.05, called d4r2nb_
  
• d4r2nb1 appears in SCOPe 2.07
  
• d4r2nb1 appears in the current release, SCOPe 2.08