Lineage for d1nsba_ (1nsb A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17093Species Influenza B virus, different strains [TaxId:11520] [50945] (11 PDB entries)
  8. 17100Domain d1nsba_: 1nsb A: [27597]

Details for d1nsba_

PDB Entry: 1nsb (more details), 2.2 Å

PDB Description: the 2.2 angstroms resolution crystal structure of influenza b neuraminidase and its complex with sialic acid

SCOP Domain Sequences for d1nsba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsba_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal

SCOP Domain Coordinates for d1nsba_:

Click to download the PDB-style file with coordinates for d1nsba_.
(The format of our PDB-style files is described here.)

Timeline for d1nsba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nsbb_