Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) |
Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
Protein automated matches [227031] (3 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [275930] (3 PDB entries) |
Domain d4r1pe1: 4r1p E:2-327 [275966] Other proteins in same PDB: d4r1pa2, d4r1pb2, d4r1pc2, d4r1pd2, d4r1pe2, d4r1pf2 automated match to d2ajta2 complexed with mn |
PDB Entry: 4r1p (more details), 2.3 Å
SCOPe Domain Sequences for d4r1pe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1pe1 c.85.1.0 (E:2-327) automated matches {Geobacillus kaustophilus [TaxId: 235909]} mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg ygfggegdwktaalvrlmkvmadgkg
Timeline for d4r1pe1: