![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) ![]() |
![]() | Family b.43.2.0: automated matches [227252] (1 protein) not a true family |
![]() | Protein automated matches [227032] (4 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:235909] [275932] (3 PDB entries) |
![]() | Domain d4r1pf2: 4r1p F:328-496 [275965] Other proteins in same PDB: d4r1pa1, d4r1pb1, d4r1pc1, d4r1pd1, d4r1pe1, d4r1pf1 automated match to d2ajta1 complexed with mn |
PDB Entry: 4r1p (more details), 2.3 Å
SCOPe Domain Sequences for d4r1pf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1pf2 b.43.2.0 (F:328-496) automated matches {Geobacillus kaustophilus [TaxId: 235909]} tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrg
Timeline for d4r1pf2: