Lineage for d1a4qb_ (1a4q B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17044Fold b.68: 6-bladed beta-propeller [50938] (4 superfamilies)
  4. 17045Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 17046Family b.68.1.1: Sialidases (neuraminidases) [50940] (5 proteins)
  6. 17047Protein Influenza neuraminidase [50943] (2 species)
  7. 17093Species Influenza B virus, different strains [TaxId:11520] [50945] (11 PDB entries)
  8. 17099Domain d1a4qb_: 1a4q B: [27596]

Details for d1a4qb_

PDB Entry: 1a4q (more details), 1.9 Å

PDB Description: influenza virus b/beijing/1/87 neuraminidase complexed with dihydropyran-phenethyl-propyl-carboxamide

SCOP Domain Sequences for d1a4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4qb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza B virus, different strains}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal

SCOP Domain Coordinates for d1a4qb_:

Click to download the PDB-style file with coordinates for d1a4qb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4qa_