Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) |
Family b.43.2.0: automated matches [227252] (1 protein) not a true family |
Protein automated matches [227032] (5 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [275932] (5 PDB entries) |
Domain d4r1qf2: 4r1q F:328-496 [275959] Other proteins in same PDB: d4r1qa1, d4r1qb1, d4r1qc1, d4r1qd1, d4r1qe1, d4r1qf1 automated match to d2ajta1 complexed with mn, sst |
PDB Entry: 4r1q (more details), 2.25 Å
SCOPe Domain Sequences for d4r1qf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1qf2 b.43.2.0 (F:328-496) automated matches {Geobacillus kaustophilus [TaxId: 235909]} tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrg
Timeline for d4r1qf2: