SCOPe 2.06: Domain d4r1qc1: 4r1q C:3-327

Lineage for d4r1qc1 (4r1q C:3-327)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
   consists of two domains of similar topology, 3 layers (a/b/a) each
   Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
   Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families)

5. Family c.85.1.0: automated matches [227251] (1 protein)
   not a true family

6. Protein automated matches [227031] (3 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [275930] (3 PDB entries)

8. Domain d4r1qc1: 4r1q C:3-327 [275951]
   Other proteins in same PDB: d4r1qa2, d4r1qb2, d4r1qc2, d4r1qd2, d4r1qe2, d4r1qf2
   automated match to d2ajta2
   complexed with mn, sst

Details for d4r1qc1

PDB Entry: 4r1q, 2.25 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase in complex with l-arabitol

PDB Compounds: (C:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1qc1:

Sequence; same for both SEQRES and ATOM records:

>d4r1qc1 c.85.1.0 (C:3-327) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
gfggegdwktaalvrlmkvmadgkg

Timeline for d4r1qc1:

• d4r1qc1 first appeared in SCOPe 2.05
  
• d4r1qc1 appears in SCOPe 2.07
  
• d4r1qc1 appears in the current release, SCOPe 2.08