Lineage for d1a4qa_ (1a4q A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
consists of six 4-stranded beta-sheet motifs; meander
Superfamily b.68.1: Sialidases [50939] (3 families) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) 
Protein Influenza neuraminidase [50943] (9 species) 
Species Influenza B virus [TaxId:11520] [50945] (20 PDB entries) 
Domain d1a4qa_: 1a4q A: [27595]
complexed with ca, dpc, nag
Details for d1a4qa_
PDB Entry: 1a4q (more details), 1.9 Å
PDB Description: influenza virus b/beijing/1/87 neuraminidase complexed with dihydropyran-phenethyl-propyl-carboxamide
PDB Compounds: (A:) NeuraminidaseSCOPe Domain Sequences for d1a4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4qa_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus [TaxId: 11520]}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal
SCOPe Domain Coordinates for d1a4qa_:
Click to download the PDB-style file with coordinates for d1a4qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4qa_:
- d1a4qa_ first appeared (with stable ids) in SCOP 1.55
- d1a4qa_ appears in SCOPe 2.07
View in 3D
