| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) ![]() |
| Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
| Protein automated matches [227031] (3 species) not a true protein |
| Species Geobacillus kaustophilus [TaxId:235909] [275930] (5 PDB entries) |
| Domain d4r1qb1: 4r1q B:3-327 [275944] Other proteins in same PDB: d4r1qa2, d4r1qb2, d4r1qc2, d4r1qd2, d4r1qe2, d4r1qf2 automated match to d2ajta2 complexed with mn, sst |
PDB Entry: 4r1q (more details), 2.25 Å
SCOPe Domain Sequences for d4r1qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1qb1 c.85.1.0 (B:3-327) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
lslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeeir
rvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdfm
nlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvarf
gdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydivp
agrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaegy
gfggegdwktaalvrlmkvmadgkg
Timeline for d4r1qb1: