Lineage for d4r1od1 (4r1o D:2-327)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910317Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2910318Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2910356Family c.85.1.0: automated matches [227251] (1 protein)
    not a true family
  6. 2910357Protein automated matches [227031] (3 species)
    not a true protein
  7. 2910358Species Geobacillus kaustophilus [TaxId:235909] [275930] (5 PDB entries)
  8. 2910374Domain d4r1od1: 4r1o D:2-327 [275938]
    Other proteins in same PDB: d4r1oa2, d4r1ob2, d4r1oc2, d4r1od2, d4r1oe2, d4r1of2
    automated match to d2ajta2

Details for d4r1od1

PDB Entry: 4r1o (more details), 2.4 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase
PDB Compounds: (D:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1od1 c.85.1.0 (D:2-327) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mlslrpyefwfvtgsqhlygeealkqveehsrimvnewnrdsvfpfpfvfksvvttpeei
rrvcleanaseqcagvvtwmhtfspakmwiggllelrkpllhlhtqfnrdipwdsidmdf
mnlnqsahgdreygfigarmgvarkvvvghwedpevrerlakwmrtavafaesrnlkvar
fgdnmrevavtegdkvgaqiqfgwsvngygigdlvqyirdvseqkvnelldeyeelydiv
pagrqegpvresireqarielglkaflqdgnftaftttfedlhgmkqlpglavqrlmaeg
ygfggegdwktaalvrlmkvmadgkg

SCOPe Domain Coordinates for d4r1od1:

Click to download the PDB-style file with coordinates for d4r1od1.
(The format of our PDB-style files is described here.)

Timeline for d4r1od1: