Class a: All alpha proteins [46456] (286 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (7 species) not a true protein |
Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries) |
Domain d5czga_: 5czg A: [275908] automated match to d4nrba_ complexed with bmf, na, unx |
PDB Entry: 5czg (more details), 1.45 Å
SCOPe Domain Sequences for d5czga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5czga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 679716]} gmsknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdg iekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv
Timeline for d5czga_: