SCOPe 2.05: Domain d5czga_: 5czg A:

Lineage for d5czga_ (5czg A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries)

8. Domain d5czga_: 5czg A: [275908]
   automated match to d4nrba_
   complexed with bmf, na, unx

Details for d5czga_

PDB Entry: 5czg, 1.45 Å

PDB Description: crystal structure analysis of hypothetical bromodomain tb427.10.7420 from trypanosoma brucei in complex with bromosporine

PDB Compounds: (A:) Hypothetical Bromodomain

SCOPe Domain Sequences for d5czga_:

Sequence; same for both SEQRES and ATOM records:

>d5czga_ a.29.2.0 (A:) automated matches {Trypanosoma brucei [TaxId: 679716]}
gmsknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdg
iekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv

Timeline for d5czga_:

• d5czga_ is new in SCOPe 2.05-stable
  
• d5czga_ is called d5czga1 in SCOPe 2.06
  
• d5czga_ appears in the current release, SCOPe 2.08, called d5czga1