Lineage for d5czga1 (5czg A:1-114)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2317847Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries)
  8. 2317848Domain d5czga1: 5czg A:1-114 [275908]
    Other proteins in same PDB: d5czga2
    automated match to d4nrba_
    complexed with bmf, na, unx

Details for d5czga1

PDB Entry: 5czg (more details), 1.45 Å

PDB Description: crystal structure analysis of hypothetical bromodomain tb427.10.7420 from trypanosoma brucei in complex with bromosporine
PDB Compounds: (A:) Hypothetical Bromodomain

SCOPe Domain Sequences for d5czga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5czga1 a.29.2.0 (A:1-114) automated matches {Trypanosoma brucei [TaxId: 679716]}
msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi
ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv

SCOPe Domain Coordinates for d5czga1:

Click to download the PDB-style file with coordinates for d5czga1.
(The format of our PDB-style files is described here.)

Timeline for d5czga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5czga2