Lineage for d1nman_ (1nma N:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065006Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2065104Domain d1nman_: 1nma N: [27590]
    Other proteins in same PDB: d1nmah_, d1nmal_
    complexed with nag; mutant

Details for d1nman_

PDB Entry: 1nma (more details), 3 Å

PDB Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
PDB Compounds: (N:) n9 neuraminidase

SCOPe Domain Sequences for d1nman_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nman_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnw

SCOPe Domain Coordinates for d1nman_:

Click to download the PDB-style file with coordinates for d1nman_.
(The format of our PDB-style files is described here.)

Timeline for d1nman_: