Class g: Small proteins [56992] (98 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries) |
Domain d5ct1a1: 5ct1 A:38-125 [275897] Other proteins in same PDB: d5ct1a2, d5ct1b2 automated match to d1nk1a1 complexed with nhe |
PDB Entry: 5ct1 (more details), 2 Å
SCOPe Domain Sequences for d5ct1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ct1a1 g.10.1.1 (A:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl wfpfnsmssgvkkefghefdlyenkdyi
Timeline for d5ct1a1: