Lineage for d5ct1a1 (5ct1 A:38-125)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637806Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 2637807Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 2637808Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 2637809Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. 2637810Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)
  8. 2637832Domain d5ct1a1: 5ct1 A:38-125 [275897]
    Other proteins in same PDB: d5ct1a2, d5ct1b2
    automated match to d1nk1a1
    complexed with nhe

Details for d5ct1a1

PDB Entry: 5ct1 (more details), 2 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with ches
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d5ct1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ct1a1 g.10.1.1 (A:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

SCOPe Domain Coordinates for d5ct1a1:

Click to download the PDB-style file with coordinates for d5ct1a1.
(The format of our PDB-style files is described here.)

Timeline for d5ct1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ct1a2