Lineage for d1ncdn_ (1ncd N:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2074755Protein Influenza neuraminidase [50943] (4 species)
  7. 2074766Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2074865Domain d1ncdn_: 1ncd N: [27589]
    Other proteins in same PDB: d1ncdh1, d1ncdh2, d1ncdl1, d1ncdl2
    complexed with ca, nag

Details for d1ncdn_

PDB Entry: 1ncd (more details), 2.9 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
PDB Compounds: (N:) influenza a subtype n9 neuraminidase

SCOPe Domain Sequences for d1ncdn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncdn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
irefnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
rgkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnn
nasaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfke
gkilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyics
pvltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvp
naltddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
snsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d1ncdn_:

Click to download the PDB-style file with coordinates for d1ncdn_.
(The format of our PDB-style files is described here.)

Timeline for d1ncdn_: