Class b: All beta proteins [48724] (176 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein Influenza neuraminidase [50943] (2 species) |
Species Influenza A virus, different strains [TaxId:11320] [50944] (61 PDB entries) Uniprot P03472 84-470 |
Domain d1ncdn_: 1ncd N: [27589] Other proteins in same PDB: d1ncdh1, d1ncdh2, d1ncdl1, d1ncdl2 complexed with ca, nag |
PDB Entry: 1ncd (more details), 2.9 Å
SCOPe Domain Sequences for d1ncdn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncdn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} irefnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti rgkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnn nasaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfke gkilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyics pvltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvp naltddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt snsivsmcssteflgqwnwpdgakieyfl
Timeline for d1ncdn_:
View in 3D Domains from other chains: (mouse over for more information) d1ncdh1, d1ncdh2, d1ncdl1, d1ncdl2 |