Lineage for d1ncdn_ (1ncd N:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301738Fold b.68: 6-bladed beta-propeller [50938] (8 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 301739Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 301740Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 301741Protein Influenza neuraminidase [50943] (2 species)
  7. 301742Species Influenza A virus, different strains [TaxId:11320] [50944] (48 PDB entries)
  8. 301792Domain d1ncdn_: 1ncd N: [27589]
    Other proteins in same PDB: d1ncdh1, d1ncdh2, d1ncdl1, d1ncdl2
    complexed with ca, man, nag

Details for d1ncdn_

PDB Entry: 1ncd (more details), 2.9 Å

PDB Description: refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex

SCOP Domain Sequences for d1ncdn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncdn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains}
irefnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
rgkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnn
nasaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfke
gkilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyics
pvltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvp
naltddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
snsivsmcssteflgqwnwpdgakieyfl

SCOP Domain Coordinates for d1ncdn_:

Click to download the PDB-style file with coordinates for d1ncdn_.
(The format of our PDB-style files is described here.)

Timeline for d1ncdn_: