Lineage for d5cs5a1 (5cs5 A:38-125)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962914Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 1962915Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 1962916Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 1962917Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. 1962918Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)
  8. 1962930Domain d5cs5a1: 5cs5 A:38-125 [275887]
    Other proteins in same PDB: d5cs5a2, d5cs5b2
    automated match to d1nk1a1
    complexed with pin

Details for d5cs5a1

PDB Entry: 5cs5 (more details), 1.9 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with pipes
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d5cs5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cs5a1 g.10.1.1 (A:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

SCOPe Domain Coordinates for d5cs5a1:

Click to download the PDB-style file with coordinates for d5cs5a1.
(The format of our PDB-style files is described here.)

Timeline for d5cs5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cs5a2