Lineage for d5cs9b2 (5cs9 B:126-209)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033315Domain d5cs9b2: 5cs9 B:126-209 [275884]
    Other proteins in same PDB: d5cs9a1, d5cs9b1
    automated match to d1nk1a2
    complexed with edo, mes

Details for d5cs9b2

PDB Entry: 5cs9 (more details), 2 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with mes
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d5cs9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cs9b2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d5cs9b2:

Click to download the PDB-style file with coordinates for d5cs9b2.
(The format of our PDB-style files is described here.)

Timeline for d5cs9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cs9b1