Lineage for d5cs3b2 (5cs3 B:126-209)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963115Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1963116Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1963117Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1963134Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 1963135Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)
  8. 1963173Domain d5cs3b2: 5cs3 B:126-209 [275874]
    Other proteins in same PDB: d5cs3a1, d5cs3b1
    automated match to d1nk1a2
    complexed with ep1

Details for d5cs3b2

PDB Entry: 5cs3 (more details), 2.5 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with (h)epps
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d5cs3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cs3b2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d5cs3b2:

Click to download the PDB-style file with coordinates for d5cs3b2.
(The format of our PDB-style files is described here.)

Timeline for d5cs3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cs3b1