SCOPe 2.08: Domain d5cs3a1: 5cs3 A:38-125

Lineage for d5cs3a1 (5cs3 A:38-125)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d5cs3a1: 5cs3 A:38-125 [275871]
   Other proteins in same PDB: d5cs3a2, d5cs3b2
   automated match to d1nk1a1
   complexed with ep1

Details for d5cs3a1

PDB Entry: 5cs3, 2.5 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with (h)epps

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d5cs3a1:

Sequence; same for both SEQRES and ATOM records:

>d5cs3a1 g.10.1.1 (A:38-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

Timeline for d5cs3a1:

• d5cs3a1 first appeared in SCOPe 2.05
  
• d5cs3a1 appears in SCOPe 2.07